Starting at: $245.00
| SKU | Package Size | Price | Quantity | Add to Cart |
|---|---|---|---|---|
| IX03430-1 | 1mg | Starting at: $3,744.00 | ||
| IX03430-10 | 10µg | Starting at: $245.00 | ||
| IX03430-50 | 50µg | Starting at: $687.00 |
Starting at: $699.00
Starting at: $1,012.00
Overview
| Synonyms | Transforming growth factor beta-3,TGFB3, TGF-beta-3,Latency-associated peptide,LAP |
| Description | Transforming growth factor beta 3(TGFB3) is a member of a TGF -β superfamily which is defined by their structural and functional similarities. TGFB3 is secreted as a complex with LAP. This latent form of TGFB3 becomes active upon cleavage by plasmin, matrix metalloproteases, thrombospondin -1, and a subset of integrins. It binds with high affinity to TGF- β RII, a type II serine/threonine kinase receptor. TGFB3 is involved in cell differentiation, embryogenesis and development. It is believed to regulate molecules involved in cellular adhesion and extracellular matrix (ECM) formation during the process of palate development. Without TGF-β3, mammals develop a deformity known as a cleft palate.
Recombinant human TGF-β3 produced by a mammalian expression system is a polypeptide chain containing 112 amino acids. A fully biologically active molecule; rh TGF-β3 a molecular mass of 12.7 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques. |
| Source | Human Cells |
| Biological Activity | ED50 <0.2 ng/ml, measured in a cell proliferation assay using mouse HT-2 cells. |
| Sequence |
Ala³⁰¹-Ser⁴¹² (Accession #:P10600);
ALDTNYCFRNLEENCCVRPLYIDFRQDLGWKWVH EPKGYFANFCSGPCPYLRSADTTHSTVLGLYNTL NPEASASPCCVPQDLEPLTILYYVGRTPKVEQLS NMVVKSCKCS |
Properties
| Measured Molecular Weight | 12.7 kDa; observed by reducing SDS-PAGE. |
| Purity | > 95% as analyzed by SDS-PAGE. |
| Formulation | Lyophilized from a 0.2 μm filtered solution in 4mM HCl. |
| Reconstitution | Reconstituted in ddH₂O at 100 μg/ml. |
| Endotoxin Level | < 1 EU/μg; determined by LAL method. |
| Storage | Lyophilized recombinant TGF-β3, human remains stable up to 6 months at lower than -70°C from date of receipt. Upon reconstitution; Human TGF-β3 should be stable up to 1 week at 4°C or up to 3 months at -20°C. For long term storage it is recommended that a carrier protein (example 0.1% BSA) be added. Avoid repeated freeze-thaw cycles. |